CENP-A (Centromere Protein A)

Centromere proteins are a group of proteins which form and/or mediate the function of centromeres, the central structures of chromosomes to which spindle fibers/microtubuli attach and pull the chromosomes apart in cell division. The centromere protein A (CENPA) is one of them. CENPA contains a histone H3 related histone fold domain and can be incorporated into centromeric chromatin due to its histone-like properties. Anti-CENPA autoantibodies are an important marker for diagnosis of Scleroderma / CREST syndrome.

As an autoantigen, CENP-A binds with IgG-type human auto-antibodies.

MSYYHHHHHHDYDIPTTENLYFQGAGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRLAREICVKFTRGVDFNWQAQALLALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG

Standard ELISA test, line/dot assay and microarray assay with positive/negative sera panels.

Lyophilized at 1 mg/mL in storage buffer (20mM Tris, 150mM NaCl, 8M Urea, PH8.0).

Add deionized water to prepare a working stock solution of approximately 1 mg/mL and let thelyophilized pellet dissolve completely.

Expressed in insect Sf9 cells with total 164 AA. Mw: 19.0 KDa (calculated).

N-terminal 6xHis-tag and TEV cleavage site, 25 extra AA (highlighted).

Recombinant antigen for research use or manufacturing only.

Store lyophilized protein at –20°C. Aliquot reconstituted protein and store at –80°C.  Avoid repeatedfreezing /thawing cycles.

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.