Ro/SS-A (52 kDa)

Ro/SSA ribonucleoproteins are involved in RNA quality control and cellular stress response to UV irradiation, and comprise of a single polypeptide and four small RNA molecules including the 60 kDa Ro protein. Ro/SSA interacts with autoantigens in patients with Sjogren syndrome and systemic lupus erythematosus.

As an autoantigen, SSA/Ro60 binds with IgG-type human auto-antibodies.

MSYYHHHHHHDYDIPTTENLYFQGAEESVNQMQPLNEKQIANSQDGYVWQVTDMNRLHRFLCFGSEGGTYYIKEQKLGLENAEALIRLIEDGRGCEVIQEIKSFSQEGRTTKQEPMLFALAICSQCSDISTKQAAFKAVSEVCRIPTHLFTFIQFKKDLKESMKCGMWGRALRKAIADWYNEKGGMALALAVTKYKQRNGWSHKDLLRLSHLKPSSEGLAIVTKYITKGWKEVHELYKEKALSVETEKLLKYLEAVEKVKRTRDELEVIHLIEEHRLVREHLLTNHLKSKEVWKALLQEMPLTALLRNLGKMTANSVLEPGNSEVSLVCEKLCNEKLLKKARIHPFHILIALETYKTGHGLRGKLKWRPDEEILKALDAAFYKTFKTVEPTGKRFLLAVDVSASMNQRVLGSILNASTVAAAMCMVVTRTEKDSYVVAFSDEMVPCPVTTDMTLQQVLMAMSQIPAGGTDCSLPMIWAQKTNTPADVFIVFTDNETFAGGVHPAIALREYRKKMDIPAKLIVCGMTSNGFTIADPDDRGMLDMCGFDTGALDVIRNFTLDMI

Standard ELISA test, line/dot assay and microarray assay with positive/negative sera panels.

Lyophilized at 1 mg/mL in storage buffer (20mM Tris, 300-500mM NaCl, 10% Glycerol, PH8.0).

Add deionized water to prepare a working stock solution of approximately 1 mg/mL and let the lyophilized pellet dissolve completely.

Expressed in insect Sf9 cells with total 499 AA. Mw: 57.1 KDa (calculated).

N-terminal 6xHis-tag and TEV cleavage site, 25 extra AA (highlighted).

Recombinant antigen for research use or manufacturing only.

Store lyophilized protein at –20°C. Aliquot reconstituted protein and store at –80°C.  Avoid repeatedfreezing /thawing cycles.

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.