PCNA (Human Proliferating Cell Nuclear Antigen)

PCNA is a co-factor of DNA polymerase delta, which forms a trimer ring around a DNA double-helix and is involved in in DNA synthesis, repair and processing, the regulation of cell cycle and even apoptosis. Autoantibody against PCNA occurs in patients with systemic lupus with a rare specificity (<10% of SLE patients).

As an autoantigen, PCNA binds with IgG-type human auto-antibodies.

MSYYHHHHHHDYDIPTTENLYFQGAFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS

Standard ELISA test, line/dot assay and microarray assay with positive/negative sera panels.

Lyophilized at 1 mg/mL in storage buffer (20mM Tris, 300-500mM NaCl, 10% Glycerol, PH8.0).

Add deionized water to prepare a working stock solution of approximately 1 mg/mL and let thelyophilized pellet dissolve completely.

Expressed in insect Sf9 cells with total 285 AA. Mw: 31.7 KDa (calculated).

N-terminal 6xHis-tag and TEV cleavage site, 25 extra AA (highlighted).

Recombinant antigen for research use or manufacturing only.

Store lyophilized protein at –20°C. Aliquot reconstituted protein and store at –80°C.  Avoid repeatedfreezing /thawing cycles.

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.