SmD1

Small nuclear ribonucleoprotein complexes (abbreviated as U-snRNP) are essential for splicing of precursor mRNA molecules. Seven different Sm proteins aggregate into a heteroheptameric protein core, including small nuclear ribonucleoprotein Sm D1 (SmD1 or snRNPD1). In the blood of patients with systemic lupus erythematosus, antinuclear antibodies are developed with Sm specificity.

As an autoantigen, SmD1 binds with IgG-type human auto-antibodies.

MSYYHHHHHHDYDIPTTENLYFQGAKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLVDVEPKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR

Standard ELISA test, line/dot assay and microarray assay with positive/negative sera panels.

Lyophilized at 1 mg/mL in storage buffer (50mM Tris, 300mM NaCl, 0.4M L-Arginine, PH8.0).

Add deionized water to prepare a working stock solution of approximately 1 mg/mL and let the lyophilized pellet dissolve completely.

Expressed in insect Sf9 cells with total 143 AA. Mw: 16.2 KDa (calculated).

N-terminal 6xHis-tag and TEV cleavage site, 25 extra AA (highlighted).

Recombinant antigen for research use or manufacturing only.

Store lyophilized protein at –20°C. Aliquot reconstituted protein and store at –80°C.  Avoid repeatedfreezing /thawing cycles.

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.