U1-snRNP C

Small nuclear ribonucleoprotein complexes (abbreviated as U-snRNP) are essential for splicing of precursor mRNA molecules. U1-snRNP is the most abundant RNP particle in the nucleus and consists of one small uridylate-rich RNA (U1 RNA) complexed with several proteins, and the three 68/70 kDa (snRNP68/70), A polypeptides (snRNPA) and C polypeptides (snRNPC) are unique to the U1-snRNP particle. Autoantibodies to U1-snRNP are present in 95% of patients with Mixed Connective Tissue Disease (MCTD) and 30% of patients with SLE.

As an autoantigen, RNP-C binds with IgG-type human auto-antibodies.

MSYYHHHHHHDYDIPTTENLYFQGAPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLIDKTTAAFQQGKIPPTPFSAPPPAGAMIPPPPSLPGPPRPGMMPAPHMGGPPMMPMMGPPPPGMMPVGPAPGMRPPMGGHMPMMPGPPMMRPPARPMMVPTRPGMTRPDR

Standard ELISA test, line/dot assay and microarray assay with positive/negative sera panels.

Lyophilized at 1 mg/mL in storage buffer (20mM Tris, 300-500mM NaCl, 10% Glycerol, PH8.0).

Add deionized water to prepare a working stock solution of approximately 1 mg/mL and let thelyophilized pellet dissolve completely.

Expressed in insect Sf9 cells with total 183 AA. Mw: 20.4 KDa (calculated).

N-terminal 6xHis-tag and TEV cleavage site, 25 extra AA (highlighted).

Recombinant antigen for research use or manufacturing only.

Store lyophilized protein at –20°C. Aliquot reconstituted protein and store at –80°C.  Avoid repeated freezing /thawing cycles.

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.